Cat: IPD-X37036

Recombinant Human GSTM5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GSTM5

  • 简介

    GSTM5 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles, crucial for cellular detoxification. Its enzymatic activity, addressing both exogenous and endogenous compounds, is essential for eliminating harmful substances and maintaining cellular homeostasis, highlighting GSTM5's protective role against toxic insults. GSTM5 Protein, Human (N-His) is the recombinant human-derived GSTM5 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Glutathione S-transferase Mu 5; GST class-mu 5; GSTM5-5; GSTM5

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P46439

  • Expression Region

    M1-K218

  • AA Sequence

    MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK

  • Protein Length

    Full Length

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GSTM5, a member of the glutathione S-transferase (GST) family, plays a critical role in cellular detoxification processes by catalyzing the conjugation of glutathione to a variety of electrophilic compounds. This enzyme is particularly relevant in the context of xenobiotic metabolism, where it aids in the detoxification of harmful substances. Research has indicated that GSTM5 may be involved in the development of resistance to chemotherapeutic agents in certain cancers, highlighting its potential as a biomarker for cancer prognosis and treatment response. The study of GSTM5 recombinant proteins has garnered attention due to their ability to provide insights into the enzyme's biochemical properties, substrate specificity, and potential interactions with various ligands. This research is crucial for understanding the functional roles of GSTM5 in human health and disease, particularly in the mechanisms of drug metabolism and the physiological implications of genetic polymorphisms associated with this enzyme. Additionally, recombinant GSTM5 can be utilized in therapeutic applications, including the development of targeted drug delivery systems or adjuvants that enhance the efficacy of existing treatments. As scientists continue to unravel the complexities of GSTM5, the enzyme's role in disease mechanisms, particularly in cancer and environmental toxin exposure, remains a vital area of study, paving the way for innovative approaches in personalized medicine and toxicology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US