Analytical Data
-
Gene name
DDOST
-
简介
DDOST is a key subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the initial glycan transfer during protein N-glycosylation. This co-translational process begins with the transfer of defined glycans to asparagine residues in the nascent polypeptide chain. DDOST Protein, Human is the recombinant human-derived DDOST protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit; DDOST; KIAA0115; OST48
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P39656-1
-
Expression Region
S43-P427
-
AA Sequence
SGPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
-
Protein Length
Lumenal Domain
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDOST (asparagine-linked glycosylation 1) is a crucial enzyme involved in the process of N-glycosylation, which is essential for the proper folding and stability of many glycoproteins. Recent research has highlighted the importance of DDOST in various physiological processes, including cell signaling, immune responses, and developmental biology. Abnormalities in DDOST expression and function have been linked to several diseases, including cancer and neurodegenerative disorders, underscoring its potential as a therapeutic target. The study of DDOST recombinant proteins has gained traction due to advances in molecular biology techniques, enabling the detailed investigation of its structure-function relationships. By producing DDOST in a recombinant form, researchers can dissect its enzymatic activity, identify potential inhibitors, and explore its role in glycoprotein biosynthesis. Moreover, the availability of recombinant DDOST facilitates high-throughput screening for drug discovery and allows for the development of innovative strategies to modulate its activity in pathological conditions. Understanding the mechanistic underpinnings of DDOST's role in glycosylation pathways could pave the way for novel therapeutic approaches, making it a significant focus in biomedical research.
