Cat: IPD-X24483

Recombinant E.coli Outer membrane 蛋白 A/OmpA Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Outer membrane 蛋白 A/OmpA

  • 简介

    Outer membrane protein A (OmpA) ensures the structural integrity of the bacterial cell wall and cooperates with TolR to stabilize the peptidoglycan layer. As a porin, OmpA controls the permeability of small solutes. Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane protein A/OmpA protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ompA; Z1307; ECs1041; Outer membrane protein A; Outer membrane porin A

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    N-SUMO;N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P0A911

  • Expression Region

    W164-A346

  • AA Sequence

    WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

  • Protein Length

    Partial

  • Molecular Weight

    35.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Outer membrane protein A (OmpA) is a crucial component of the outer membrane of Gram-negative bacteria, playing significant roles in maintaining membrane integrity, facilitating nutrient transport, and contributing to bacterial pathogenesis. Due to its abundant expression and immunogenicity, OmpA has garnered attention as a potential target for vaccine development and therapeutic intervention. Research into OmpA has revealed its ability to form oligomers, its involvement in biofilm formation, and its role in host-pathogen interactions. Furthermore, the recombinant production of OmpA has become a focal point for functional studies, allowing for the exploration of its structural and biochemical properties without the complexities associated with the native bacterial context. This research not only aids in understanding the mechanistic details of OmpA's function but also enhances the development of OmpA-based applications, including diagnostics and drug delivery systems. The ongoing studies of OmpA emphasize its potential as a versatile platform for biotechnological applications, prompting further investigation into its recombinant forms and the implications for infectious disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US