Analytical Data
-
Gene name
CTSF
-
简介
CTSF Protein, a thiol protease, participates in intracellular protein degradation and turnover. Its association with tumor invasion and metastasis suggests potential involvement in critical cellular processes related to cancer progression. CTSF Protein, Human (His) is the recombinant human-derived CTSF protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
Cathepsin F; CathepsinF; CATSF; CLN13; Ctsf
-
Species
Human
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBX1
-
Expression Region
P273-D484
-
AA Sequence
PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD
-
Protein Length
Partial
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTSF (cathepsin F) is a lysosomal cysteine protease that plays a significant role in various cellular processes, including protein degradation, antigen processing, and apoptosis. Its involvement in multiple pathological conditions, including autoimmune diseases, cancer, and neurodegeneration, has sparked considerable research interest. Recent studies have demonstrated that CTSF can influence the immune response and modulate inflammation, indicating its potential as a therapeutic target. Additionally, the intricate regulation of CTSF activity and its tissue-specific functions present unique challenges and opportunities for drug development. Recombinant CTSF protein has become a pivotal tool for elucidating its biological mechanisms and interactions, facilitating the understanding of its role in disease progression. Researchers are increasingly adopting recombinant protein techniques to analyze the structure-function relationship of CTSF, aiming to identify novel inhibitors or activators that could lead to innovative treatment strategies. Given the limited understanding of CTSF's precise role in various biological contexts, ongoing studies are crucial for unraveling its potential as a biomarker or target in therapeutic applications. The exploration of recombinant CTSF also holds promise for advances in biochemistry and molecular biology, providing insights into lysosomal function and the broader implications for cellular homeostasis.
