Cat: IPD-X36784

Recombinant Human Creatine kinase M-type/CKM Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Creatine kinase M-type/CKM

  • 简介

    KCRM is a cytoplasmic creatine kinase isoenzyme responsible for participating in energy transduction and maintaining energy homeostasis. KCRM reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate) and is an important serum marker of myocardial infarction. Creatine kinase M-type/CKM Protein, Human (HEK293, His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCreatine kinase M-type/CKMM, His; Creatine kinase M-type; Creatine kinase M chain; M-CK; CKM; CKMM

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    AAP35439.1

  • Expression Region

    M1-K381

  • AA Sequence

    MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

  • Protein Length

    Full Length

  • Molecular Weight

    46.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Creatine kinase M-type (CKM) is an important enzyme involved in cellular energy metabolism, primarily found in skeletal and cardiac muscles. It plays a critical role in the ATP-PCr energy system, facilitating the transfer of high-energy phosphate groups from phosphocreatine to adenosine diphosphate (ADP) to generate adenosine triphosphate (ATP), especially during short bursts of high-intensity exercise. Research into CKM has gained momentum due to its potential implications in various physiological and pathological conditions, including muscle disorders, heart diseases, and metabolic syndromes. The ability to produce recombinant CKM protein has facilitated detailed studies on its structure, function, and regulation, allowing scientists to explore its enzymatic mechanisms and interaction with other cellular components. Furthermore, understanding CKM's role can lead to novel therapeutic strategies for energy metabolism-related diseases. The advent of recombinant DNA technology enables the production of high-purity CKM, which is essential for biochemical assays, structural studies, and drug development. This research is vital not only for basic science but also for translational applications in medicine and sports science, emphasizing the importance of CKM in maintaining energy homeostasis in muscle tissues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US