Cat: IPD-X24232

Recombinant Human HLA-C Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HLA-C

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HLA class I histocompatibility antigen, C alpha chain; HLA-C protein; MHC class I antigen; HLA-Cw

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O78179

  • Expression Region

    C25-I308

  • AA Sequence

    CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI

  • Protein Length

    Partial

  • Molecular Weight

    36.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HLA-C (Human Leukocyte Antigen-C) is a critical component of the Major Histocompatibility Complex (MHC) class I molecules, which play a vital role in the immune response by presenting intracellular peptides to CD8+ T cells. This ability directly influences the recognition of infected or malignant cells, making HLA-C essential in both immune defense and transplantation immunology. Recent studies have shown that variations in HLA-C alleles are associated with different immune responses to pathogens, as well as with susceptibility to autoimmune diseases and the success of organ transplants. Therefore, understanding HLA-C's structure and function is paramount for developing targeted immunotherapies. Recombinant proteins of HLA-C are increasingly being utilized in research to elucidate its interactions with T cell receptors and to assess its role in immune evasion mechanisms employed by tumors and viruses. Furthermore, these recombinant proteins can serve as valuable tools for vaccine development and personalized medicine approaches by aiding in the identification of specific epitopes that can enhance T cell responses. The advances in genetic engineering technologies have facilitated the production of stable and functional HLA-C recombinant proteins, opening new avenues for experimental and clinical research aimed at harnessing the immune system to fight diseases. Overall, the exploration of HLA-C recombinant proteins can provide insights into immune regulation and pave the way for novel therapeutic strategies in infectious diseases, cancer, and autoimmune disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US