Cat: IPD-X24227

Recombinant Human HLA-A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HLA-A

  • 简介

    HLA-A protein is an antigen-presenting MHCI molecule that is critical for mediating reproductive and antiviral immunity. It partners with B2M to provide self- and viral peptides as ligands that inhibit and activate KIR on NK cells. HLA-A Protein, Human (His) is the recombinant human-derived HLA-A protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HLA class I histocompatibility antigen,A-1 alpha chain

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04439-1

  • Expression Region

    G25-I308

  • AA Sequence

    GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    36.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of HLA-A recombinant proteins is rooted in the pivotal role that Human Leukocyte Antigen (HLA) molecules play in the immune response and organ transplantation. HLA-A is a critical class I molecule, responsible for presenting endogenous peptides to CD8+ T cells, thus facilitating the detection of infected or malignant cells by the immune system. Understanding the structural and functional characteristics of HLA-A is essential for improving transplant compatibility and developing effective immunotherapies. Researchers have focused on producing recombinant HLA-A proteins to study their antigen-binding properties, interactions with T cell receptors, and implications in autoimmune diseases and cancer. These recombinant proteins serve as valuable tools for vaccine development, as they can help identify epitopes that elicit robust immune responses. Additionally, the exploration of HLA-A variants can provide insights into population genetics and disease susceptibility, ultimately aiding in personalized medicine approaches. Advances in protein engineering and expression systems have enabled the production of high-purity HLA-A recombinant proteins, making them readily accessible for various biomedical applications. Thus, the research on HLA-A recombinant proteins is vital for enhancing our understanding of immune mechanisms and improving therapeutic strategies in transplantation and cancer immunotherapy.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US