Analytical Data
-
Gene name
TMEM173
- Application
-
Alternative Names
NET23; ERIS; MPYS; MITA; STING; Endoplasmic Reticulum Interferon Stimulator; Stimulator Of Interferon Genes Protein; Mediator of IRF3 activation
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His-Tag
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q86WV6
-
Expression Region
159~373aa
-
AA Sequence
LAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQ QTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLE DILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLI SGMEKPLP
-
Molecular Weight
28.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
TMEM173, also known as STING (Stimulator of Interferon Genes), is a critical component of the innate immune response, playing a pivotal role in the detection of cytosolic DNA from both endogenous and exogenous sources. Research on TMEM173 has gained significant importance due to its involvement in activating the STING pathway, which subsequently leads to the production of type I interferons and other cytokines, essential for mounting an effective immune response against infections and tumors. Dysregulation of this pathway has been linked to various diseases, including autoimmune disorders and cancers, highlighting its potential as a therapeutic target. The study of recombinant TMEM173 protein offers an avenue to better understand its structure-function relationships, mechanisms of action, and interactions with other cellular components. As scientists continue to explore the role of TMEM173 in immunotherapy and vaccine development, the generation of high-purity, functional TMEM173 protein through recombinant techniques is vital for elucidating its mechanisms and identifying new therapeutic strategies. This protein serves as a key tool for both basic research and clinical applications, paving the way for advancements in immunotherapy and precision medicine.











