Cat: IPD-X36587

Recombinant Human Citrate Synthase/CS Protein (Baculovirus),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Citrate Synthase/CS

  • 简介

    Citrate synthase (CS) is a key enzyme in carbohydrate metabolism, especially in the tricarboxylic acid (TCA) cycle, where it catalyzes the conversion of oxaloacetate and acetyl-CoA into citric acid. This enzymatic process represents the first and critical step in the TCA cycle, which is the basis of cellular energy production. Citrate Synthase/CS Protein, Human (sf9, His) is the recombinant human-derived Citrate Synthase/CS protein, expressed by Sf9 insect cells , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Citrate synthase, mitochondrial; Citrate (Si)-synthase; CS

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75390

  • Expression Region

    A28-G466

  • AA Sequence

    ASSTNLKDILADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Citrate synthase (CS) is a crucial enzyme in the citric acid cycle, catalyzing the condensation of acetyl-CoA and oxaloacetate to form citrate, a pivotal intermediate for aerobic metabolism. The study of recombinant Citrate Synthase has gained prominence in recent years due to its implications in various metabolic disorders, including obesity and diabetes, as well as its potential role in bioengineering applications, such as the production of biodegradable plastics and biofuels. Advances in genetic engineering have allowed for the production of CS in systems like bacteria and yeast, facilitating its purification and characterization. By using recombinant DNA technology, researchers can modify the enzyme to enhance its stability, substrate specificity, and catalytic efficiency. These modifications not only provide insights into enzyme kinetics and regulation but also pave the way for innovative biotechnological applications. Understanding CS at the molecular level offers a deeper insight into metabolic pathways and energy production, contributing to the advancement of metabolic engineering strategies aimed at optimizing cellular processes for improved industrial yields. The ongoing research on recombinant CS continues to elucidate its structure-function relationships and expands its potential applications in health and industry, making it a focal point in metabolic research and biocatalysis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US