Analytical Data
-
Gene name
SIRT1
- Application
-
Alternative Names
SIR2L1; Silent Mating Type Information Regulation 2 Homolog 1; NAD-Dependent Deacetylase Sirtuin-1; SIR2-like protein 1; SirtT1 75 kDa fragment
-
Species
Mouse
-
Source
E. coli
-
Tag
N-terminal His Tag
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q923E4
-
Expression Region
236~490aa
-
AA Sequence
EDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMF DIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLE QVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLA IMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEV PQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYA
-
Molecular Weight
30kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
SIRT1, a member of the sirtuin family of NAD+-dependent deacetylases, has garnered significant attention in the fields of aging research, metabolic regulation, and disease prevention. This protein plays a critical role in cellular processes by modifying various target proteins through deacetylation, which can influence gene expression, DNA repair, and cellular stress responses. Research has shown that SIRT1 is involved in the regulation of several physiological functions, including glucose homeostasis, lipid metabolism, and inflammation, making it a potential therapeutic target for age-related diseases such as diabetes, obesity, and neurodegenerative disorders. Additionally, SIRT1's involvement in modulating lifespan and promoting cellular longevity has led to its exploration in anti-aging therapies. The development of recombinant SIRT1 proteins has facilitated in-depth studies on its enzymatic activity and interactions with other cellular pathways, offering insights into its mechanistic roles. These investigations have sparked interest in pharmacological strategies aimed at enhancing SIRT1 activity as a means to ameliorate age-associated health decline and improve overall metabolic health. Understanding SIRT1's biochemical pathways and regulatory mechanisms continues to be crucial in uncovering its potential applications in biomedicine, especially in the context of cellular aging and metabolic dysregulation.











