Cat: IPD-X36581

Recombinant Mouse SIRT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SIRT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SIR2L1; Silent Mating Type Information Regulation 2 Homolog 1; NAD-Dependent Deacetylase Sirtuin-1; SIR2-like protein 1; SirtT1 75 kDa fragment

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q923E4

  • Expression Region

    236~490aa

  • AA Sequence

    EDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMF DIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLE QVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLA IMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEV PQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYA

  • Molecular Weight

    30kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SIRT1, a member of the sirtuin family of NAD+-dependent deacetylases, has garnered significant attention in the fields of aging research, metabolic regulation, and disease prevention. This protein plays a critical role in cellular processes by modifying various target proteins through deacetylation, which can influence gene expression, DNA repair, and cellular stress responses. Research has shown that SIRT1 is involved in the regulation of several physiological functions, including glucose homeostasis, lipid metabolism, and inflammation, making it a potential therapeutic target for age-related diseases such as diabetes, obesity, and neurodegenerative disorders. Additionally, SIRT1's involvement in modulating lifespan and promoting cellular longevity has led to its exploration in anti-aging therapies. The development of recombinant SIRT1 proteins has facilitated in-depth studies on its enzymatic activity and interactions with other cellular pathways, offering insights into its mechanistic roles. These investigations have sparked interest in pharmacological strategies aimed at enhancing SIRT1 activity as a means to ameliorate age-associated health decline and improve overall metabolic health. Understanding SIRT1's biochemical pathways and regulatory mechanisms continues to be crucial in uncovering its potential applications in biomedicine, especially in the context of cellular aging and metabolic dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US