Cat: IPD-X24060

Recombinant Cynomolgus LIV-1/SLC39A6 Protein (Baculovirus),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LIV-1/SLC39A6

  • 简介

    LIV-1/SLC39A6 is a zinc influx transporter that regulates zinc homeostasis and induces epithelial-mesenchymal transition (EMT). Used in conjunction with SLC39A10, it can promote cellular zinc absorption and trigger EMT. LIV-1/SLC39A6 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived LIV-1/SLC39A6 protein, expressed by sf9 insect cells , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC39A6; LIV-1; ZIP6; Zinc transporter ZIP6; ZIP-6

  • Species

    Cynomolgus

  • Source

    Baculovirus

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    XP_005586923

  • Expression Region

    L21-I309

  • AA Sequence

    LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI

  • Protein Length

    Partial

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LIV-1, also known as SLC39A6, is a member of the ZIP (Zinc-regulated transporter, Iron-regulated transporter-like protein) family, playing a crucial role in zinc homeostasis within cells. Research into LIV-1 has gained prominence due to its implications in cancer biology, particularly in breast cancer, where it has been identified as a potential biomarker and therapeutic target. High expression levels of LIV-1 are associated with tumor progression, metastasis, and poor patient prognosis. Moreover, LIV-1 is implicated in the transportation of zinc and other metal ions, which are vital for various cellular processes, including enzyme activity, gene expression, and cell signaling. Given the essential role of zinc in regulating cellular functions, understanding the structure and function of LIV-1/SLC39A6 is critical for elucidating its involvement in carcinogenesis and other disease states. Recent studies have focused on the recombinant production of LIV-1 protein to facilitate structure-function analyses and high-throughput screening for potential inhibitors. By characterizing this protein, researchers aim to uncover its mechanism of action in metal ion transport and its contribution to tumor behavior, ultimately paving the way for the development of novel therapeutic strategies targeting LIV-1 in cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US