Analytical Data
-
Gene name
BSSP-4
-
简介
BSSP-4 Protein is notable for its specific preference in cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA. This enzymatic selectivity indicates BSSP-4's potential modulation of specific peptide sequences, emphasizing its relevance in biological processes. BSSP-4 Protein, Human (HEK293, His) is the recombinant human-derived BSSP-4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuBrain-specific serine protease 4/BSSP-4, His; Brain-Specific Serine Protease 4; BSSP-4; Serine Protease 22; Serine Protease 26; Tryptase Epsilon; PRSS22; BSSP4; PRSS26
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZN4
-
Expression Region
A33-S317
-
AA Sequence
ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
33-37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BSSP-4 recombinant protein has emerged as an area of interest in the field of molecular biology and biotechnology due to its significant potential applications in various therapeutic and diagnostic processes. The BSSP-4 protein is derived from natural sources and has been identified as playing a crucial role in specific biological pathways, including immune response modulation and cellular signaling. Research surrounding BSSP-4 has focused on understanding its structural and functional characteristics, which could facilitate its use in developing new therapeutic agents for immune-related disorders and infectious diseases. Furthermore, the ability to produce BSSP-4 as a recombinant protein allows for easier manipulation and large-scale production, enabling more extensive studies and potential commercialization. Investigations into its interactions with other biomolecules and its biological activities are ongoing, as researchers strive to elucidate the underlying mechanisms that govern its function. The development of BSSP-4 as a recombinant product not only showcases advancements in protein engineering but also highlights the importance of precision in biotherapeutics, paving the way for innovative strategies in clinical applications and enhancing our understanding of complex biological systems. As the field advances, BSSP-4 holds promise for contributing to novel diagnostic tools and therapeutic modalities, positioning it as a key player in future biomedical research and development efforts.
