Analytical Data
-
Gene name
TPM4
-
简介
The TPM4 protein binds actin filaments in muscle and non-muscle cells and critically regulates calcium-dependent muscle contraction with the help of the vertebrate troponin complex. In smooth muscle cells, TPM4 interacts with caldesmon and contributes to contraction regulation. TPM4 Protein, Human (HEK293, His) is the recombinant human-derived TPM4 protein, expressed by HEK293 , with N-6*His labeled tag.
- Application
-
Alternative Names
Tropomyosin alpha-4 chain; TM30p1; Tropomyosin-4; TPM4
-
Species
Human
-
Source
HEK293
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P67936
-
Expression Region
A2-I248
-
AA Sequence
AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
35-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPM4 (Tropomyosin 4) is a member of the tropomyosin family of actin-binding proteins that regulate cytoskeletal dynamics and cellular processes such as motility, shape, and division. Research into TPM4 and its recombinant protein has gained significance due to its potential role in various diseases, including cancer and muscular disorders. Studies have demonstrated that altered expression of TPM4 can influence cell proliferation, migration, and invasion, suggesting its involvement in tumor progression. Furthermore, the interaction of TPM4 with other proteins in the actin cytoskeleton highlights its importance in maintaining cellular architecture. Understanding the functional implications of TPM4 reorganization at a molecular level is crucial for elucidating its biological roles. The development of recombinant TPM4 proteins allows researchers to investigate its structure-function relationships and to explore its interactions with other cytoskeletal components. This can potentially lead to therapeutic applications, particularly in designing targeted treatments for diseases characterized by cytoskeletal dysfunction. Therefore, TPM4's significance in both fundamental biology and clinical research makes it a compelling target for ongoing investigations into its mechanisms of action and potential implications in health and disease.











