Cat: IPD-X23982

Recombinant Human TPM4 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TPM4

  • 简介

    The TPM4 protein binds actin filaments in muscle and non-muscle cells and critically regulates calcium-dependent muscle contraction with the help of the vertebrate troponin complex. In smooth muscle cells, TPM4 interacts with caldesmon and contributes to contraction regulation. TPM4 Protein, Human (HEK293, His) is the recombinant human-derived TPM4 protein, expressed by HEK293 , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tropomyosin alpha-4 chain; TM30p1; Tropomyosin-4; TPM4

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P67936

  • Expression Region

    A2-I248

  • AA Sequence

    AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    35-40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TPM4 (Tropomyosin 4) is a member of the tropomyosin family of actin-binding proteins that regulate cytoskeletal dynamics and cellular processes such as motility, shape, and division. Research into TPM4 and its recombinant protein has gained significance due to its potential role in various diseases, including cancer and muscular disorders. Studies have demonstrated that altered expression of TPM4 can influence cell proliferation, migration, and invasion, suggesting its involvement in tumor progression. Furthermore, the interaction of TPM4 with other proteins in the actin cytoskeleton highlights its importance in maintaining cellular architecture. Understanding the functional implications of TPM4 reorganization at a molecular level is crucial for elucidating its biological roles. The development of recombinant TPM4 proteins allows researchers to investigate its structure-function relationships and to explore its interactions with other cytoskeletal components. This can potentially lead to therapeutic applications, particularly in designing targeted treatments for diseases characterized by cytoskeletal dysfunction. Therefore, TPM4's significance in both fundamental biology and clinical research makes it a compelling target for ongoing investigations into its mechanisms of action and potential implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US