Cat: IPD-X31730

Recombinant Human USP14 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    USP14

  • 简介

    USP14 is a proteasome-associated deubiquitinase that regulates ubiquitin dynamics by releasing ubiquitin from proteins marked for degradation. As a reversible proteasome subunit, USP14 ensures ubiquitin replenishment. USP14 Protein, Human (399a.a, His) is the recombinant human-derived USP14 protein, expressed by E. coli, with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ubiquitin carboxyl-terminal hydrolase 14; Deubiquitinating enzyme 14; Ubiquitin thioesterase 14; Ubiquitin-specific-processing protease 14; USP14; TGT

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P54578-1

  • Expression Region

    Q96-Q494

  • AA Sequence

    LASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

  • Protein Length

    Partial

  • Molecular Weight

    47.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

USP14 (Ubiquitin Specific Peptidase 14) is a pivotal deubiquitinating enzyme involved in the regulation of protein degradation, particularly in the context of the ubiquitin-proteasome system (UPS). It plays a crucial role in maintaining cellular protein homeostasis by removing ubiquitin tags from proteins destined for destruction, thereby modulating their stability and function. Research has increasingly highlighted the significance of USP14 in various physiological and pathological processes, including neurodegeneration, cancer, and immune responses. The aberrant activity of USP14 has been linked to the accumulation of misfolded proteins, which is a hallmark of debilitating diseases like Alzheimer's and Parkinson's. Consequently, there is growing interest in characterizing the biochemical properties of USP14, understanding its regulatory mechanisms, and exploring its potential as a therapeutic target. Recent studies utilizing recombinant USP14 proteins have facilitated insights into its enzymatic activity, substrate specificity, and interactions with other cellular components. These investigations not only enhance our understanding of the UPS but also open avenues for developing novel strategies to modulate USP14 function in disease contexts, emphasizing its relevance in drug discovery and developmental biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US