Cat: IPD-X31717

Recombinant Human Plasma kallikrein/KLKB1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Plasma kallikrein/KLKB1

  • 简介

    Plasma kallikrein (KLKB1) serves as an enzyme, cleaving Lys-Arg and Arg-Ser bonds to release bradykinin from HMW kininogen. It plays a crucial role in the reciprocal activation of factor XII, especially upon binding to a negatively charged surface. Besides its role in the kinin system, KLKB1 may contribute to the renin-angiotensin system by converting prorenin into renin. Plasma kallikrein/KLKB1 Protein, Human (HEK293, His) is the recombinant human-derived Plasma kallikrein/KLKB1 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1. Immobilized Human KLKB1, His Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-KLKB1 Antibody, hFc Tag with the EC50 of ≤33.8 ng/mL determined by ELISA. 2. Measured by its ability to cleave a flourogenic peptide substrate Pro-Phe-Arg-7-amido-4- methylcoumarin (PFR-AMC). The specific activity is 1207 pmol/min/μg. (Activation description: The proenzyme needs to be activated by Thermolysin for an activated form.)

  • Alternative Names

    Plasma kallikrein; PKK; KLK3; KLKB1; Fletcher factor; Kininogenin

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P03952

  • Expression Region

    G20-A638

  • AA Sequence

    GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    72-80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Plasma kallikrein, also known as KLKB1, is a serine protease involved in the kallikrein-kinin system, which plays a critical role in various physiological processes, including blood pressure regulation, inflammation, and pain sensation. Abnormalities in KLKB1 function are associated with several pathological conditions, such as hereditary angioedema and cardiovascular diseases. The recombinant form of plasma kallikrein has emerged as a crucial tool for both basic research and therapeutic applications. Studies focusing on KLKB1 are driven by the need to understand its structure, function, and regulatory mechanisms better, as well as to explore its potential as a biomarker and therapeutic target. Advances in genetic engineering and protein expression systems have enabled the production of recombinant KLKB1, facilitating detailed investigations into its enzymatic activity, substrate specificity, and interaction with inhibitors. Furthermore, this research has implications for developing novel drugs that modulate the kallikrein-kinin system for treating related disorders. Overall, the study of recombinant plasma kallikrein/KLKB1 is pivotal for elucidating its role in health and disease, advancing biomedical research, and fostering innovative therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US