Analytical Data
-
Gene name
ULBP1/RAET1I
-
简介
The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, His) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
NKG2D ligand 1; N2DL-1; NKG2DL1; ALCAN-beta; Retinoic acid early transcript 1I; UL16-binding protein 1; ULBP1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZM6
-
Expression Region
G26-P215
-
AA Sequence
GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAP
-
Protein Length
Partial
-
Molecular Weight
26-30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ULBP1, also known as RAET1I, is a member of the UL16-binding protein (ULBP) family, which plays a crucial role in the immune response by interacting with NKG2D receptors on natural killer (NK) cells and certain T cells. These interactions are significant for the recognition and elimination of stressed, infected, or tumor cells. The study of ULBP1 is particularly pertinent given its role in cancer biology and the potential for therapeutic applications in immunotherapy. Research has shown that ULBP1 expression can be modulated in various tumors, influencing immune evasion and the tumor microenvironment. Understanding the structure and function of recombinant ULBP1 protein is important for exploring its biological activity and therapeutic potential. Recombinant ULBP1 can be used to investigate its signaling pathways, receptor interactions, and the resulting immune responses, which may lead to new strategies for enhancing anti-tumor immunity. Furthermore, the development of recombinant ULBP1 could facilitate the production of diagnostic and therapeutic agents, thus contributing to the advancement of immunotherapeutic approaches in cancer treatment. Overall, the exploration of ULBP1/RAET1I offers valuable insights into immune regulation and potential clinical applications in oncology.
