Analytical Data
-
Gene name
nAChRα5
-
简介
The nAChRα5 protein induces significant conformational changes in all subunits upon acetylcholine binding, leading to the opening of ion-conducting channels in the plasma membrane. nAChRα5, composed of α and non-α (β) subunits, interacts with LYPD6 to reveal complex regulatory mechanisms in neuronal acetylcholine receptors. nAChRα5 Protein, Human (HEK293, His) is the recombinant human-derived nAChRα5 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuNeuronal acetylcholine receptor subunit alpha-5/NACHRA5, His; Neuronal Acetylcholine Receptor Subunit Alpha-5; CHRNA5; NACHRA5
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30532
-
Expression Region
R23-T254
-
AA Sequence
RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYT
-
Protein Length
Extracellular Domain
-
Molecular Weight
35-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nicotinic acetylcholine receptors (nAChRs) are important pentameric ligand-gated ion channels, playing crucial roles in fast synaptic transmission in the nervous system. Among the various subunits that compose these receptors, the alpha-5 subunit (α5) has garnered significant interest due to its unique expression patterns and involvement in various physiological and pathological processes. Research indicates that α5 is not only implicated in cognitive functions, such as learning and memory, but also in the modulation of addictive behaviors and neuropsychiatric disorders. The α5 subunit is predominantly expressed in the brain regions associated with these functions, highlighting its potential as a therapeutic target. However, the structural and functional characterization of α5-containing nAChRs remains limited, necessitating the generation of recombinant α5 proteins to facilitate detailed studies. Recombinant expression allows for the investigation of α5’s role in receptor assembly, trafficking, and pharmacological responses, providing insights into the receptor's contribution to neuronal signaling. Additionally, understanding the specific interactions of α5 with other nAChR subunits may reveal pathways that could be targeted for drug development. Overall, the study of nAChRα5 recombinant proteins is vital for elucidating the complex mechanisms underlying cholinergic signaling and its implications for treating neurodegenerative diseases and substance use disorders.











