Cat: IPD-X36207

Recombinant Mouse IL-10R beta Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-10R beta

  • 简介

    IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses. IL-10R beta Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (W223-Y251) with a His tag at the C-terminus[3].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Mouse IL-10 R alpha is present at 1 µg/mL can bind Mouse IL-10 R beta in the presence of 1 µg/mL Mouse IL-10. The ED50 for this effect is 1.098 μg/mL. Measured by its binding ability in a functional ELISA. When Mouse IL-10 R alpha is present at 1 µg/mL can bind Mouse IL-10 R beta in the presence of 1 µg/mL Mouse IL-10. The ED50 for this effect is 1.098 μg/mL.

  • Alternative Names

    Interleukin-10 receptor subunit beta; IL-10RB; CRF2-4; IL-10R2; CDw210b

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8VHM7

  • Expression Region

    M22-S222

  • AA Sequence

    MIPPPEKVRMNSVNFKNILQWEVPAFPKTNLTFTAQYESYRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSEWVNVTFCPVEDTIIGPPEMQIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKNGTNEKFQVVSPYDSEVLRNLEPWTTYCIQVQGFLLDQNRTGEWSEPICERTGNDEITPS

  • Protein Length

    Partial

  • Molecular Weight

    35-45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-10 receptor beta (IL-10Rβ) is a crucial component of the interleukin-10 receptor complex, playing a significant role in mediating the anti-inflammatory effects of IL-10, a key cytokine involved in regulating immune responses. Research on IL-10Rβ has gained attention due to its potential implications in various autoimmune diseases, inflammatory conditions, and even cancer. IL-10 is known for its ability to suppress pro-inflammatory cytokine production, thereby promoting tissue repair and maintaining immune homeostasis. The binding of IL-10 to its receptor activates downstream signaling pathways, primarily through the JAK-STAT pathway, which leads to the transcription of target genes that exert anti-inflammatory effects. However, the exact mechanisms governing IL-10Rβ function and its interactions with IL-10 and other signaling molecules are still not fully understood. The recombinant production of IL-10Rβ has facilitated detailed studies on its structure and function, providing insights into its role in immune regulation. Additionally, understanding the biological activities of IL-10Rβ could open new avenues for therapeutic interventions in diseases characterized by dysregulated immune responses. Overall, the ongoing research on IL-10Rβ is pivotal for developing novel strategies aimed at harnessing the anti-inflammatory properties of IL-10 in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US