Analytical Data
-
Gene name
IL-10R beta
-
简介
IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses. IL-10R beta Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (W223-Y251) with a His tag at the C-terminus[3].
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Mouse IL-10 R alpha is present at 1 µg/mL can bind Mouse IL-10 R beta in the presence of 1 µg/mL Mouse IL-10. The ED50 for this effect is 1.098 μg/mL. Measured by its binding ability in a functional ELISA. When Mouse IL-10 R alpha is present at 1 µg/mL can bind Mouse IL-10 R beta in the presence of 1 µg/mL Mouse IL-10. The ED50 for this effect is 1.098 μg/mL.
-
Alternative Names
Interleukin-10 receptor subunit beta; IL-10RB; CRF2-4; IL-10R2; CDw210b
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8VHM7
-
Expression Region
M22-S222
-
AA Sequence
MIPPPEKVRMNSVNFKNILQWEVPAFPKTNLTFTAQYESYRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSEWVNVTFCPVEDTIIGPPEMQIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKNGTNEKFQVVSPYDSEVLRNLEPWTTYCIQVQGFLLDQNRTGEWSEPICERTGNDEITPS
-
Protein Length
Partial
-
Molecular Weight
35-45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-10 receptor beta (IL-10Rβ) is a crucial component of the interleukin-10 receptor complex, playing a significant role in mediating the anti-inflammatory effects of IL-10, a key cytokine involved in regulating immune responses. Research on IL-10Rβ has gained attention due to its potential implications in various autoimmune diseases, inflammatory conditions, and even cancer. IL-10 is known for its ability to suppress pro-inflammatory cytokine production, thereby promoting tissue repair and maintaining immune homeostasis. The binding of IL-10 to its receptor activates downstream signaling pathways, primarily through the JAK-STAT pathway, which leads to the transcription of target genes that exert anti-inflammatory effects. However, the exact mechanisms governing IL-10Rβ function and its interactions with IL-10 and other signaling molecules are still not fully understood. The recombinant production of IL-10Rβ has facilitated detailed studies on its structure and function, providing insights into its role in immune regulation. Additionally, understanding the biological activities of IL-10Rβ could open new avenues for therapeutic interventions in diseases characterized by dysregulated immune responses. Overall, the ongoing research on IL-10Rβ is pivotal for developing novel strategies aimed at harnessing the anti-inflammatory properties of IL-10 in clinical settings.











