Cat: IPD-X23714

Recombinant Human TFPI2 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TFPI2

  • 简介

    The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, C-His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tissue Factor Pathway Inhibitor 2; TFPI-2; Placental Protein 5; PP5; TFPI2

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P48307

  • Expression Region

    D23-K213

  • AA Sequence

    DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK

  • Protein Length

    Partial

  • Molecular Weight

    18-32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TFPI2 (Tissue Factor Pathway Inhibitor 2) is a key regulatory protein associated with the tissue factor (TF) pathway of coagulation, which plays a crucial role in hemostasis and thrombosis. Originally identified as an important inhibitor of factor Xa and factor VIIa, TFPI2 has garnered attention for its potential implications in various pathological conditions, including cancer, cardiovascular diseases, and inflammatory disorders. Research has indicated that TFPI2 is involved in tumor progression and metastasis, suggesting a dual role in both promoting and inhibiting cancer cell invasion depending on the context. Moreover, its expression profiles differ across various tissues and cancer types, indicating its potential as a biomarker for disease diagnosis and prognosis. Consequently, recombinant TFPI2 proteins have been developed to explore their therapeutic applications, including anticoagulant therapies and cancer treatments. These recombinant proteins facilitate detailed studies on the structure-function relationship of TFPI2 and allow for the investigation of its mechanisms in cellular signaling pathways. Understanding the precise roles and interactions of TFPI2 in physiological and pathological processes is crucial for developing novel therapeutic strategies to target coagulation disorders and cancer therapies effectively. As the body of research surrounding TFPI2 continues to expand, it highlights the need for in-depth studies and the potential for innovations in treatment modalities that harness the functional properties of TFPI2 in clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US