Analytical Data
-
Gene name
CCND2
- Application
-
Alternative Names
rHuCCND2, His; G1/S-specific cyclin-D2; CCND2
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30279
-
Expression Region
M1-L289
-
AA Sequence
HHHHHHMELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
-
Protein Length
Full Length
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cyclin D2 (CCND2) is a key regulator of the cell cycle, specifically involved in the progression from the G1 phase to the S phase, facilitating cellular proliferation. Its dysregulation has been implicated in various cancers, making it an important target for cancer research. CCND2 operates by forming complexes with cyclin-dependent kinases (CDKs), thereby promoting the phosphorylation of retinoblastoma protein (Rb) and driving cells toward DNA synthesis. Additionally, CCND2 is associated with other cellular processes beyond cell cycle regulation, such as apoptosis and differentiation. The use of recombinant CCND2 protein for laboratory studies allows researchers to investigate its specific interactions and functions in detail, providing insights into its role in tumorigenesis. By studying the structural and functional characteristics of CCND2, scientists aim to identify potential therapeutic strategies that could inhibit its activity in cancerous cells, thereby limiting tumor growth and progression. Overall, the research on recombinant CCND2 is vital for understanding its contributions to cell cycle regulation and its implications in cancer biology, paving the way for innovative treatments targeting this pathway.











