Cat: IPD-X23661

Recombinant Human HLA-G Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HLA-G

  • 简介

    HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (HEK293, His) is the recombinant human-derived HLA-G protein, expressed by HEK293 , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    B2 microglobulin; DADB-15K14.8; HLA 6.0; HLA class I histocompatibility antigen alpha chain G; Major histocompatibility complex class I G; MHC class I antigen; MHC class I antigen G; MHC G; T-cell A locus; TCA

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P17693-1

  • Expression Region

    G25-D338

  • AA Sequence

    GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    39.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HLA-G is a non-classical human major histocompatibility complex (MHC) class I molecule with immune-regulatory properties, primarily expressed in trophoblast cells during pregnancy, but also found in various tissues under pathological conditions. It plays a crucial role in maintaining maternal-fetal tolerance by inhibiting maternal immune responses against the semi-allogeneic fetus. The unique expression patterns and functions of HLA-G have drawn significant interest for therapeutic applications, particularly in transplantation, autoimmunity, and cancer immunotherapy. Recombinant HLA-G proteins have been developed for detailed studies on its biological functions and interactions with receptors such as ILT2 and ILT4, which are implicated in modulating immune responses. Understanding the diverse roles of HLA-G can provide insights into its potential as a biomarker for immune-related disorders and its possible use in enhancing graft acceptance in transplantation. Furthermore, research into HLA-G has the potential to leverage its immune-modulatory capabilities to design novel therapeutic interventions aimed at overcoming immune-related challenges in various clinical settings. As such, the study of recombinant HLA-G proteins not only advances our knowledge of immune regulation but also paves the way for innovative strategies in clinical practice.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US