Analytical Data
-
Gene name
BIN2
- Application
-
Alternative Names
rHuBIN2, His; Bridging Integrator 2; Breast Cancer-Associated Protein 1; BIN2; BRAP1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBW5-1
-
Expression Region
M1-N244
-
AA Sequence
HHHHHHMAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSN
-
Protein Length
Partial
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BIN2 (BIS-NLS Interacting Protein 2) is a member of the clathrin-AP180/adaptor protein complex, playing a crucial role in clathrin-mediated endocytosis. It is primarily expressed in various tissues, including the brain, where it is involved in synaptic function and signaling pathways. Research on BIN2 has gained momentum due to its potential implications in neurodegenerative diseases and cancer. Studies indicate that BIN2 may regulate cellular processes such as membrane trafficking, cytoskeletal dynamics, and apoptosis. Alterations in BIN2 expression or function have been linked to various pathological conditions, highlighting its importance as a biomarker and therapeutic target. Recent advances in recombinant protein technology have enabled researchers to produce BIN2 in sufficient quantities for functional assays, structure-function studies, and drug discovery. Understanding the structure and interactions of BIN2 can provide insights into its role in cellular mechanisms and contribute to the development of targeted therapies. With the growing interest in its biological significance and therapeutic potential, continued investigation of BIN2-recombinant proteins holds promise for unraveling the complexities of disease pathways and identifying novel intervention strategies.
