Cat: IPD-X36097

Recombinant Human IL-6R alpha Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-6R alpha

  • 简介

    IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha/CD126, Human consists of 468 amino acids (M1-R468) with two fibronectin type-III-like domains contained in the N-terminal part (113-217 a.a, 218-316 a.a), and a soluble form (1-365 a.a). Soluble IL-6R (sIL-6R) binds IL-6 and dimerized gp130 to achieve trans signaling, and exhibits a tissue expression property in some immune systems. IL-6R alpha Protein, Human (M1-P365) is soluble form and produced in HEK293 cells with a C-Terminal hFc-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 4.366 ng/mL in the presence of 2 ng/mL recombinant mouse IL-6, corresponding to a specific activity is 2.29×10^5 units/mg. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 4.366 ng/mL in the presence of 2 ng/mL recombinant mouse IL-6, corresponding to a specific activity is 2.29×105 units/mg.

  • Alternative Names

    Interleukin-6 receptor subunit alpha; IL-6R-alpha; IL-6R 1; gp80; CD126

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P08887-1

  • Expression Region

    L20-P365

  • AA Sequence

    LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    80-100 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-6 receptor alpha (IL-6Rα) is a crucial component of the interleukin-6 (IL-6) signaling pathway, which plays a significant role in inflammation, immune response, and hematopoiesis. Dysregulation of this pathway has been implicated in various pathological conditions, including autoimmune diseases, chronic inflammatory disorders, and certain cancers. The soluble form of IL-6Rα, which can be generated by alternative splicing or proteolytic cleavage, has garnered interest as a potential biomarker and therapeutic target due to its involvement in pro-inflammatory signaling cascades. Research on recombinant IL-6Rα proteins has expanded our understanding of IL-6 signaling mechanisms and its implications in disease. These proteins are utilized in various experimental applications, including the study of receptor binding, signal transduction, and functional assays that explore the effects of IL-6 in different biological contexts. Additionally, the development of IL-6Rα antagonists, such as monoclonal antibodies targeting the receptor, showcases their therapeutic potential in treating IL-6 related pathologies. Ongoing studies aim to elucidate the precise roles of IL-6Rα in diverse disease states and explore its potential as a therapeutic biomarker or target, highlighting the importance of this research in developing innovative treatments for inflammatory and autoimmune diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US