Cat: IPD-X31410

Recombinant Rat Prostasin/PRSS8 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Prostasin/PRSS8

  • 简介

    Prostasin/PRSS8 Protein, featuring trypsin-like cleavage specificity, crucially activates the epithelial sodium channel (ENaC) by cleaving gamma subunits (SCNN1G) and modulating ion transport. Structurally, it forms a disulfide bond-linked heterodimer with light and heavy chains, highlighting its intricate role in cellular responses. Prostasin/PRSS8 Protein, Rat (HEK293, His) is the recombinant rat-derived Prostasin/PRSS8 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Channel-activating protease 1; CAP1; Serine protease 8

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q9ES87

  • Expression Region

    A30-R322

  • AA Sequence

    ADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVAELQPRVVPQTQESQPDGHLCNHHPVFNLAAAQKLSR

  • Protein Length

    Partial

  • Molecular Weight

    32.9 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Prostasin, also known as PRSS8, is a serine protease that plays a crucial role in various physiological processes, including epithelial cell regulation and tissue homeostasis. It is predominantly expressed in the prostate and other epithelial tissues, where it is believed to be involved in fluid regulation, signaling pathways, and cellular differentiation. Recent studies have suggested that Prostasin may have implications in cancer biology, particularly in prostate cancer, where its expression levels can correlate with tumor progression and patient prognosis. The interest in recombinant Prostasin/PRSS8 protein has surged in the scientific community due to its potential utility in therapeutic applications and as a biomarker for disease. Researchers are exploring the structural and functional characteristics of Prostasin in order to understand its mechanisms of action at the molecular level. The production of recombinant Prostasin allows for detailed studies on its enzymatic activity, interaction with substrates, and involvement in pathological conditions. Furthermore, understanding the regulatory pathways through which Prostasin operates could lead to novel therapeutic strategies targeting epithelial malignancies. Given the challenges associated with its purification and activity assays, ongoing research aims to optimize the recombinant expression systems and develop reliable assays to evaluate its functional roles. Overall, Prostasin/PRSS8 represents an intriguing target for further investigation, with the potential to contribute significantly to the fields of cancer research and regenerative medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US