Analytical Data
-
Gene name
RAC2
-
简介
The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
Ras-related C3 botulinum toxin substrate 2; GX; Small G protein; p21-Rac2
-
Species
Human
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15153
-
Expression Region
M1-C189
-
AA Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC
-
Protein Length
Partial
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAC2, a member of the Rho family of GTPases, plays a pivotal role in regulating various cellular functions, including actin cytoskeleton organization, cell migration, and immune responses. Its unique expression pattern, predominantly in hematopoietic cells, underscores its significance in immune system functioning. Research has highlighted that mutations or dysregulation of RAC2 can lead to immunodeficiencies and contribute to the development of certain cancers, making it an attractive target for therapeutic intervention. The study of RAC2 recombinant proteins is crucial for elucidating its molecular mechanisms and interactions within signaling pathways. By generating and characterizing RAC2 recombinant proteins, researchers aim to better understand its role in cellular processes and identify potential therapeutic targets for diseases associated with its dysregulation. This investigative work not only enhances our comprehension of RAC2's functional capabilities but also lays the groundwork for novel approaches in treating immune-related disorders and malignancies.
