Cat: IPD-X27882

Recombinant Others NEU2 Protein (Baculovirus),His & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NEU2

  • 简介

    The NEU2 protein plays a key role in cellular processes by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. Through its enzymatic activity, NEU2 contributes to the controlled modification of cell surface glycoconjugates, affecting various cellular functions including cell adhesion, signaling, and immune responses. NEU2 Protein, Cricetulus griseus (sf9, His-Myc) is the recombinant NEU2 protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NEU2; Sialidase-2; EC 3.2.1.18; Cytosolic sialidase; N-acetyl-alpha-neuraminidase 2

  • Species

    Others

  • Source

    Baculovirus

  • Tag

    N-10*His;C-Myc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q64393

  • Expression Region

    M1-Q379

  • AA Sequence

    MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ

  • Protein Length

    Full Length

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NEU2, a member of the neuraminidase family of enzymes, has garnered significant attention in the field of biomedical research due to its role in the cleavage of sialic acid residues from glycoproteins and glycolipids. This enzymatic activity is crucial for various biological processes, including cell signaling, immune response, and cellular interactions. Abnormalities in sialylation patterns, which NEU2 might influence, have been implicated in several pathologies, including cancer progression and neurological disorders. The recombinant production of NEU2 protein has proved essential for elucidating its structural and functional properties, enabling researchers to investigate its mechanisms of action and potential therapeutic applications. Various expression systems have been employed to generate active NEU2, facilitating purification and characterization efforts. Understanding NEU2's enzymatic activity at the molecular level could provide insights into its substrate specificity and catalytic mechanisms, enhancing our knowledge of glycan biology. Furthermore, as the interest in targeting glycosylation processes for drug development rises, NEU2 presents promising avenues for therapeutic interventions and biomarker identification in disease contexts, underscoring the importance of continued research on this recombinant protein.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US