Analytical Data
-
Gene name
CEMP1
-
简介
CEMP1 protein may play a key role in the development of periodontal tissue, promoting the differentiation of periodontal ligament cells into cementoblasts and promoting cementum formation. CEMP1 exhibits affinity for hydroxyapatite, suggesting involvement in cementum biomineralization. CEMP1 Protein, Human (P.pastoris, His) is the recombinant human-derived CEMP1 protein, expressed by P. pastoris , with N-His labeled tag.
- Application
-
Alternative Names
Cementoblastoma-derived protein 1; Cementum protein 1; Cementum protein 23; CEMP1; CP-23; CP23
-
Species
Human
-
Source
P. pastoris
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PRD7
-
Expression Region
M1-G247
-
AA Sequence
MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEMP1, or Cementum Protein 1, is a key extracellular matrix protein primarily associated with cementum formation, a vital component of periodontal tissue that attaches teeth to the alveolar bone. Understanding the function and biological significance of CEMP1 is crucial for insights into periodontal disease, tooth mobility, and strategies for dental regenerative therapies. Research has shown that CEMP1 plays a role in cellular activities such as mineralization and cell adhesion, thus influencing tissue engineering approaches for periodontal regeneration. The study of CEMP1 as a recombinant protein provides a unique opportunity to investigate its properties and potential applications in regenerative dentistry. By producing CEMP1 recombinantly, scientists can explore its role in osteogenesis and cementogenesis, offering promising avenues for developing therapeutic strategies against periodontal diseases. This research not only enhances our knowledge of periodontal biology but also opens up possibilities for innovative treatments through the engineering of biomaterials that incorporate CEMP1 to promote tissue regeneration and stability in dental applications.
