Analytical Data
-
Gene name
PLAU/uPA
-
简介
uPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (411a.a, HEK293, His, solution) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Urokinase-Type Plasminogen Activator; U-Plasminogen Activator; uPA; PLAU
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P00749-1
-
Expression Region
S21-L431
-
AA Sequence
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
45-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLAU (plasminogen activator, urokinase) and its enzyme uPA (urokinase-type plasminogen activator) play pivotal roles in the process of fibrinolysis, where they convert plasminogen to plasmin, subsequently breaking down fibrin in blood clots. This mechanism is crucial in various physiological processes, including tissue remodeling, wound healing, and immune response. Abnormal regulation of uPA is linked to several pathological conditions, notably cancer metastasis, where enhanced uPA activity facilitates tumor invasion and migration. Moreover, uPA levels have been associated with poor prognosis in various malignancies, making it a significant biomarker for cancer diagnostics and a potential therapeutic target. Researchers have increasingly focused on the recombinant production of PLAU/uPA to study its structure-function relationship, optimize its therapeutic applications, and develop novel inhibitors. Advances in recombinant DNA technology have allowed for the efficient expression and purification of the uPA protein, enabling detailed investigations into its enzymatic activity, interaction with its receptor (uPAR), and its role in the tumor microenvironment. Understanding the molecular mechanisms governing uPA's activity could lead to innovative strategies for cancer treatment, including the design of specific inhibitors that can impede its function without disrupting normal fibrinolytic processes. Furthermore, the exploration of PLAU/uPA's role extends beyond oncology into other fields, such as cardiovascular diseases and fibrotic disorders, highlighting its potential as a multifaceted target for therapeutic intervention. Overall, the study of PLAU/uPA recombinant proteins not only enhances our understanding of its biological significance but also opens avenues for developing targeted therapies aimed at malignancies and other diseases characterized by aberrant plasminogen activation.











