Cat: IPD-X23379

Recombinant Human PLAU/uPA Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLAU/uPA

  • 简介

    uPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (411a.a, HEK293, His, solution) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Urokinase-Type Plasminogen Activator; U-Plasminogen Activator; uPA; PLAU

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P00749-1

  • Expression Region

    S21-L431

  • AA Sequence

    SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    45-55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLAU (plasminogen activator, urokinase) and its enzyme uPA (urokinase-type plasminogen activator) play pivotal roles in the process of fibrinolysis, where they convert plasminogen to plasmin, subsequently breaking down fibrin in blood clots. This mechanism is crucial in various physiological processes, including tissue remodeling, wound healing, and immune response. Abnormal regulation of uPA is linked to several pathological conditions, notably cancer metastasis, where enhanced uPA activity facilitates tumor invasion and migration. Moreover, uPA levels have been associated with poor prognosis in various malignancies, making it a significant biomarker for cancer diagnostics and a potential therapeutic target. Researchers have increasingly focused on the recombinant production of PLAU/uPA to study its structure-function relationship, optimize its therapeutic applications, and develop novel inhibitors. Advances in recombinant DNA technology have allowed for the efficient expression and purification of the uPA protein, enabling detailed investigations into its enzymatic activity, interaction with its receptor (uPAR), and its role in the tumor microenvironment. Understanding the molecular mechanisms governing uPA's activity could lead to innovative strategies for cancer treatment, including the design of specific inhibitors that can impede its function without disrupting normal fibrinolytic processes. Furthermore, the exploration of PLAU/uPA's role extends beyond oncology into other fields, such as cardiovascular diseases and fibrotic disorders, highlighting its potential as a multifaceted target for therapeutic intervention. Overall, the study of PLAU/uPA recombinant proteins not only enhances our understanding of its biological significance but also opens avenues for developing targeted therapies aimed at malignancies and other diseases characterized by aberrant plasminogen activation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US