Cat: IPD-X27808

Recombinant Human RCVRN Protein (P. pastoris),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RCVRN

  • 简介

    The RCVRN protein is a calcium sensor that regulates phototransduction in cone and rod photoreceptors, enhancing the light sensitivity of cone photoreceptors in dark conditions. Under low light, it prolongs RHO/rhodopsin activation in rod photoreceptor cells by inhibiting GRK1-mediated phosphorylation. RCVRN Protein, Human (P.pastoris, His) is the recombinant human-derived RCVRN protein, expressed by P. pastoris , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    23kDa photoreceptor cell-specific protein; CAR; CAR protein; p26; Protein CAR; RCV1; RCVRN; Recoverin; S-modulin

  • Species

    Human

  • Source

    P. pastoris

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35243

  • Expression Region

    G2-A200

  • AA Sequence

    GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RCVRN (Recoverin) is a calcium-binding protein that plays a crucial role in the visual transduction pathways within photoreceptor cells of the retina. Research on RCVRN has evolved significantly due to its implications in retinal diseases, such as retinitis pigmentosa and age-related macular degeneration. The protein functions as a photoreceptor-specific modulator, where it interacts with various signaling proteins to regulate the activity of phosphodiesterase, thereby controlling the concentration of cyclic GMP in response to light stimuli. Notably, RCVRN's involvement in phototransduction makes it an essential component for maintaining photoreceptor health and function. Recent studies have also explored the therapeutic potential of RCVRN in gene therapy approaches, aiming to restore vision in patients with inherited retinal degenerative diseases. Moreover, understanding the structure-function relationship of RCVRN has broadened insights into calcium-mediated signaling mechanisms across various biological systems. As the understanding of RCVRN expands, it paves the way for innovative interventions and treatments for retinal pathologies, highlighting its significance in both basic and applied biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US