Analytical Data
-
Gene name
Vinculin
-
简介
Vinculin Protein, an actin-binding protein, is crucial for cell adhesion, morphology, and mechanosensing. It regulates E-cadherin expression and enhances mechanosensing. Vinculin forms complexes with THSD1, PTK2/FAK1, TLN1, and VCL, and interacts with APBB1IP, NRAP, CTNNB1, SYNM, SORBS1, and CTNNA1. Its interaction with CTNNA1 is necessary for localization to cell-cell junctions. Vinculin also binds to ACTN4, causing conformational changes. Vinculin Protein, Human (GST) is the recombinant human-derived Vinculin protein, expressed by E. coli , with N-GST labeled tag.
- Application
-
Alternative Names
CMD1W; CMH15; Epididymis luminal protein 114; HEL114; Metavinculin; MV; MVCL; Vinculin
-
Species
Human
-
Source
E. coli
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18206
-
Expression Region
2P-235E
-
AA Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVE
-
Protein Length
Partial
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Vinculin is a crucial cytoskeletal protein that plays a significant role in cell adherence, signaling, and migration by connecting integrins to the actin cytoskeleton. It is involved in various cellular processes, including mechanotransduction, which allows cells to respond to mechanical stimuli from their environment. Understanding the structure and function of vinculin is essential for elucidating its role in cellular integrity and dynamics, as well as its implications in various diseases, including cancer and heart diseases. Considering the importance of vinculin in these biological processes, researchers have focused on producing recombinant vinculin proteins to study their structure-function relationships in detail. Recombinant protein production allows for the generation of large quantities of pure protein, enabling extensive biochemical and biophysical characterization, as well as the exploration of its interactions with other cellular components. Moreover, studying recombinant vinculin can provide insights into the regulatory mechanisms of cell adhesion and motility, ultimately contributing to therapeutic strategies for diseases associated with vinculin dysfunction. Recent advancements in molecular biology techniques have facilitated the cloning, expression, and purification of vinculin, thereby enhancing its accessibility for research purposes. As researchers continue to unravel the complexities of vinculin's role in cellular processes, the development of recombinant vinculin serves as a vital tool in understanding its contributions to both normal physiology and disease pathology.
