Cat: IPD-X11306

Recombinant Mouse IL-1RL2 Protein (HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-1RL2

  • 简介

    The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized IL-1F5 (HY-P77007) at 1 μg/mL (100 μL/well) can bind IL-1RL2 Protein. The ED50 for this effect is 2.046 μg/mL. Immobilized IL-1F5 (HY-P77007) at 1 μg/mL (100 μL/well) can bind IL-1RL2 Protein, the ED50 for this effect is 2.046 μg/mL.

  • Alternative Names

    Interleukin-1 receptor-like 2; IL1RL2; IL-36 receptor; IL-36R; IL-1Rrp2; IL1R-rp2

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    > 90% as determined by SDS-PAGE.

  • Uniprot

    Q9ERS7

  • Expression Region

    D22-R338, A158V

  • AA Sequence

    DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    50-70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL-1RL2, also known as interleukin-1 receptor like 2, is a member of the IL-1 receptor family that plays a crucial role in modulating immune responses and inflammation. Research into IL-1RL2 has gained momentum due to its potential involvement in various inflammatory diseases and its unique capacity to interact with both conventional IL-1 family cytokines and novel players like IL-33. This interaction can lead to diverse biological functions, such as the activation of immune cells, promotion of T helper cell differentiation, and modulation of inflammatory pathways. Studies indicate that IL-1RL2 is expressed in various cell types, including epithelial cells, fibroblasts, and immune cells, suggesting its importance in tissue homeostasis and immune regulation. Furthermore, dysregulation of IL-1RL2 signaling has been linked to chronic inflammatory conditions, autoimmune diseases, and even cancer, highlighting its therapeutic potential as a target for drug development. The production of recombinant IL-1RL2 protein has enabled researchers to investigate its biological activity in vitro and in vivo, paving the way for the discovery of novel strategies to manipulate IL-1RL2 pathways for therapeutic benefits. Understanding the intricate signaling mechanisms of IL-1RL2 could lead to innovative treatments for inflammatory and autoimmune disorders, making it a significant focus of immunological research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US