Analytical Data
-
Gene name
TSST-1
- Application
-
Alternative Names
tst; Toxic shock syndrome toxin-1; TSST-1
-
Species
Staphylococcus aureus
-
Source
E. coli
-
Tag
N-His;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06886
-
Expression Region
S41-N234
-
AA Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
-
Protein Length
Full Length of Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSST-1 (Toxic Shock Syndrome Toxin-1) is a potent superantigen produced by Staphylococcus aureus, associated with toxic shock syndrome (TSS), a severe illness characterized by high fever, rash, and multi-organ failure. The interaction between TSST-1 and the immune system leads to the activation of a large number of T cells, resulting in a cytokine storm that can be life-threatening. Research on recombinant TSST-1 utilizes genetic engineering techniques to produce the protein in vitro, enabling detailed study of its structure and function without the risks associated with pathogenic strains. This approach provides insights into the mechanisms of TSS and the potential for developing vaccines or therapeutics targeting TSST-1 or its effects. Additionally, recombinant TSST-1 can serve as a tool for studying superantigenic stimulation and its role in various autoimmune diseases. Understanding the biology of TSST-1 can also contribute to the development of strategies to modulate immune responses, with implications for both infectious diseases and immunological disorders. Overall, the study of recombinant TSST-1 is vital for advancing our knowledge of superantigens and their impact on human health.
