Cat: IPD-X27709

Recombinant Staphylococcus aureus TSST-1 Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TSST-1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    tst; Toxic shock syndrome toxin-1; TSST-1

  • Species

    Staphylococcus aureus

  • Source

    E. coli

  • Tag

    N-His;N-SUMO

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06886

  • Expression Region

    S41-N234

  • AA Sequence

    STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TSST-1 (Toxic Shock Syndrome Toxin-1) is a potent superantigen produced by Staphylococcus aureus, associated with toxic shock syndrome (TSS), a severe illness characterized by high fever, rash, and multi-organ failure. The interaction between TSST-1 and the immune system leads to the activation of a large number of T cells, resulting in a cytokine storm that can be life-threatening. Research on recombinant TSST-1 utilizes genetic engineering techniques to produce the protein in vitro, enabling detailed study of its structure and function without the risks associated with pathogenic strains. This approach provides insights into the mechanisms of TSS and the potential for developing vaccines or therapeutics targeting TSST-1 or its effects. Additionally, recombinant TSST-1 can serve as a tool for studying superantigenic stimulation and its role in various autoimmune diseases. Understanding the biology of TSST-1 can also contribute to the development of strategies to modulate immune responses, with implications for both infectious diseases and immunological disorders. Overall, the study of recombinant TSST-1 is vital for advancing our knowledge of superantigens and their impact on human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US