Analytical Data
-
Gene name
PPP1CC
-
简介
PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
- Application
-
Alternative Names
Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit; PP-1G; Protein Phosphatase 1C Catalytic Subunit; PPP1CC
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His;C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36873-1
-
Expression Region
M1-K323
-
AA Sequence
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
30-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP1CC, or Protein Phosphatase 1 Catalytic Subunit Gamma, plays a crucial role in various cellular processes by modulating protein phosphorylation states. It is a key component of the protein phosphatase 1 (PP1) family, involved in regulating cell signaling, metabolism, and cell cycle progression. Abnormalities in its expression or function have been linked to several diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. Research into PPP1CC has intensified due to its potential as a therapeutic target; understanding its structure and function can unveil new strategies for drug development. The reconstitution of PPP1CC as a recombinant protein has become an essential approach for studying its biochemical properties, interaction with regulatory subunits, and the impact of post-translational modifications. By utilizing advanced techniques such as crystallography and mass spectrometry, researchers aim to elucidate the precise mechanisms of PPP1CC in cellular signaling pathways. Furthermore, investigating how PPP1CC interacts with other proteins could provide insights into its role in disease progression, making it a critical focus of molecular and cellular biology research. As a result, the study of PPP1CC not only enhances our understanding of fundamental biological processes but also paves the way for innovative therapeutic strategies.











