Cat: IPD-X27681

Recombinant Human TPP2 Protein,His & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TPP2

  • 简介

    TPP2 protein, a cytosolic tripeptidyl-peptidase, is a vital component of the ubiquitin-proteasome pathway, operating downstream of the 26S proteasome. It plays a crucial role in maintaining intracellular amino acid homeostasis by releasing N-terminal tripeptides from polypeptides. Furthermore, TPP2 protein is implicated in stimulating adipogenesis, contributing to processes involved in adipose tissue formation. TPP2 Protein, Human (Myc, His) is the recombinant human-derived TPP2 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TPP2; Tripeptidyl-peptidase 2; TPP-2; EC 3.4.14.10; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase II; TPP-II

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-His;C-Myc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29144

  • Expression Region

    D44-H264

  • AA Sequence

    DTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH

  • Protein Length

    Partial

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TPP2, or "TPP2 Recombination Protein," plays a significant role in various biological processes, including gene regulation, protein degradation, and cellular response to stress. Initially discovered for its involvement in RNA metabolism, TPP2 has since been recognized for its crucial functions in the RNA exosome complex, where it aids in RNA processing and surveillance. Recent studies highlight its importance in the regulation of mRNA stability and translation, influencing gene expression patterns across different cellular contexts. The recombinant production of TPP2 has garnered considerable interest due to its potential applications in biotechnology and medicine. Understanding TPP2's structure and function can lead to insights into cellular mechanisms associated with diseases, particularly in cancer and genetic disorders where RNA processing is disrupted. Furthermore, the ability to produce TPP2 in a recombinant form allows researchers to investigate its interactions with various molecular partners, paving the way for targeted therapeutics and novel interventions in RNA-related pathologies. The exploration of TPP2 as a research focus is emblematic of the broader interest in RNA biology, underscoring the need for detailed studies on its biophysical properties and regulatory mechanisms. These efforts could ultimately contribute to the development of innovative strategies for modulating gene expression and enhancing therapeutic outcomes in various clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US