Analytical Data
-
Gene name
IL-23R beta
-
简介
IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein is consists of 308 amino acids (M1-S311) with a transmembrane domain (230-254 a.a.). IL-20R beta Protein, Cynomolgus (HEK293, Fc) is fibronectin type-III domain-containing protein, produced in HEK293 cells with a C-Terminal Fc-tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL-19, at 0.1 μg/mL (100 μL/well) can bind IL-20R beta. The ED50 for this effect is 38.15 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human IL-19, at 0.1 μg/mL (100 μL/well) can bind IL-20R beta. The ED50 for this effect is 38.15 ng/mL.
-
Alternative Names
Interleukin-20 receptor subunit beta; IL-20R-beta; IL-20RB; FNDC6; IL-20R2; DIRS1
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.
-
Uniprot
XP_005545913.1
-
Expression Region
D30-A230
-
AA Sequence
DEVAILPAPQNLSVLSTNMKHLLMWSPVTVPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTPPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA
-
Protein Length
Partial
-
Molecular Weight
29-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-23 receptor (IL-23R) is a crucial component of the immune system, playing a significant role in modulating inflammatory responses and autoimmunity. It interacts with IL-23, a cytokine implicated in various autoimmune diseases, including psoriasis, inflammatory bowel disease, and multiple sclerosis. The study of IL-23R recombinant protein is fundamental for understanding its function and the underlying mechanisms of IL-23-mediated signaling pathways. Researchers are interested in the therapeutic potential of targeting IL-23R, as blocking this receptor could provide novel treatment strategies for patients suffering from IL-23-associated conditions. The recombinant protein can be used for various applications, including developing specific inhibitors and antibodies that target IL-23R, as well as investigating the receptor's structural and functional properties. By elucidating the biology of IL-23R, scientists aim to improve diagnostic and therapeutic approaches, addressing unmet clinical needs in managing inflammatory and autoimmune diseases. Furthermore, understanding variations in IL-23R expression and signaling can lead to personalized medicine strategies, optimizing treatment efficacy based on individual genetic backgrounds. Overall, research on IL-23R recombinant protein holds promise for advancing our understanding of immune regulation and discovering innovative therapies for debilitating inflammatory diseases.
