Analytical Data
-
Gene name
VSIG8
-
简介
V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines, chemokines and other proteins on T cells, and also suppresses T cell proliferation and differentiation of na茂ve T cells. VSIG8 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG8 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
V-set and immunoglobulin domain-containing protein 8; VSIG8; C1orf204
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DPA2
-
Expression Region
V22-G263
-
AA Sequence
VRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIG
-
Protein Length
Extracellular Domain
-
Molecular Weight
57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VSIG8, or V-set and immunoglobulin domain-containing protein 8, is a protein that belongs to the immunoglobulin superfamily and has emerged as a significant topic in immunological research due to its potential roles in immune regulation and tumor biology. Its expression is predominantly observed in immune cells, suggesting a critical function in modulating immune responses. Previous studies indicate that VSIG8 may participate in the regulation of T cell activation and tolerance, particularly in the context of autoimmune diseases and cancer. Research has also shown that VSIG8 interacts with specific receptors to influence cell signaling pathways, thereby affecting the outcome of immune responses. As cancer therapies increasingly focus on harnessing the immune system, understanding the role of molecules like VSIG8 can reveal new avenues for immunotherapy. Additionally, its expression patterns in various cancers highlight its potential as a biomarker and a therapeutic target. Thus, ongoing research aims to elucidate the precise mechanisms by which VSIG8 modulates immune activity and its implications in disease, paving the way for innovative therapeutic strategies.
