Analytical Data
-
Gene name
RTBDN
-
简介
The RTBDN Protein, binding riboflavin, potentially transports retinal flavins, playing a crucial role in essential vitamin transport. Its specific riboflavin binding suggests importance in supporting retinal health through flavin molecule regulation, impacting various biological processes. RTBDN Protein, Human (HEK293, His) is the recombinant human-derived RTBDN protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Retbindin; RTBDN
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BSG5
-
Expression Region
S31-P229
-
AA Sequence
SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RTBDN (Reversion Inducing Cysteine-Rich Protein with Kazal Motifs) is a protein implicated in several biological processes, particularly those related to cell signaling and development. Research into RTBDN has gained momentum due to its potential role in various diseases, including neurodegenerative disorders and certain cancers. The protein is characterized by its unique structural elements, including cysteine-rich domains and Kazal motifs, which suggest a multifunctional nature that may involve interactions with other proteins, impacting both intracellular and extracellular signaling pathways. Studies have indicated that RTBDN can influence cellular proliferation, differentiation, and apoptosis, making it a key player in maintaining cellular homeostasis. The investigation of RTBDN’s functions and mechanisms at the molecular level is essential for understanding its contributions to pathological conditions and could lead to novel therapeutic strategies. Recent advancements in recombinant protein technology have enabled more efficient production and purification of RTBDN, facilitating further research into its biological activities and potential as a biomarker or therapeutic target. As a result, RTBDN is positioned at the forefront of protein research, with implications that extend from fundamental biology to clinical applications.











