Cat: IPD-X35597

Recombinant Human RIGI Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RIGI

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RIG-I; RIGI; DEAD(Asp-Glu-Ala-Asp)box Polypeptide 58; Probable ATP-Dependent RNA Helicase DDX58; RIG-I-like receptor; RIG-I-like receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    O95786

  • Expression Region

    550~776aa

  • AA Sequence

    DALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRD PSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLK PGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNL VILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSI LRLQTWDEAVF

  • Molecular Weight

    29.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DDX58, also known as RIG-I (retinoic acid-inducible gene I), is a crucial member of the DExD/H-box helicase family that plays a pivotal role in the innate immune response to viral infections. This protein functions as a pattern recognition receptor, detecting viral RNA in the cytoplasm and activating signaling pathways that lead to the production of type I interferons and pro-inflammatory cytokines. Given its essential function in antiviral defense, DDX58 has garnered significant attention in research focused on infectious diseases and immunology. The study of DDX58 recombinant proteins aims to elucidate its structure-function relationships and regulatory mechanisms in immune responses. Additionally, understanding how DDX58 interacts with viral components can provide insights into viral evasion strategies and inform therapeutic interventions. The use of recombinant DDX58 in experimental settings allows for the detailed analysis of its biochemical properties, signaling dynamics, and potential modulation by pharmacological agents. As such, ongoing research into DDX58 not only enhances our understanding of host-pathogen interactions but also holds promise for the development of novel antiviral strategies and immunotherapeutics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US