Cat: IPD-X30916

Recombinant Mouse Arginase-1/ARG1 Protein (P. pastoris),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Arginase-1/ARG1

  • 简介

    Arginase-1 (ARG1) plays a key role in the urea cycle, converting L-arginine into urea and L-ornithine. This cycle maintains L-arginine homeostasis, which is critical for nitric oxide synthase to compete for arginine. Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Arginase-1/ARG1 protein, expressed by P. pastoris , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Arg1Arginase-1; EC 3.5.3.1; Liver-type arginase; Type I arginase

  • Species

    Mouse

  • Source

    P. pastoris

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q61176

  • Expression Region

    M1-K323

  • AA Sequence

    MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK

  • Protein Length

    Full Length

  • Molecular Weight

    36.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Arginase-1 (ARG1), an enzyme that is crucial for the urea cycle, catalyzes the conversion of L-arginine to L-ornithine and urea. This enzyme plays a pivotal role not only in nitrogen metabolism but also in the regulation of various physiological and pathological processes, including immune response, tissue repair, and even cancer progression. Elevated ARG1 levels have been associated with the promotion of tumor growth and evasion of immune surveillance, as it can modulate immune cell function by depleting L-arginine, an essential amino acid for T cell activation. Consequently, researchers have focused on producing recombinant ARG1 proteins to better understand its enzymatic activity, regulation, and potential therapeutic applications. Recombinant protein studies have enabled the investigation of ARG1's structure-function relationships, as well as its interaction with inhibitors and substrates. Additionally, recombinant ARG1 can serve as a valuable tool for developing targeted therapies aimed at normalizing arginine metabolism in cancer and other diseases characterized by ARG1 overactivity. As a result, the exploration of ARG1 as both a biomarker and a therapeutic target has garnered significant interest in the fields of immunology and oncology, highlighting the need for more in-depth studies on its biological functions and clinical implications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US