Cat: IPD-X30876

Recombinant Human ADAMDEC1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADAMDEC1

  • 简介

    ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuADAM-like protein decysin-1, His; ADAMDEC-1; ADAM-like protein decysin-1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15204

  • Expression Region

    K206-E470

  • AA Sequence

    KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    38.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADAMDEC1, a member of the ADAM (A Disintegrin and Metalloproteinase) family, is a transmembrane protein known for its role in cell adhesion, migration, and proteolytic activity. It is primarily expressed in dendritic cells and has garnered interest due to its involvement in immune responses and potential implications in inflammatory diseases. Recent studies have shown that ADAMDEC1 can regulate the function of dendritic cells and influence T-cell activation, indicating its crucial role in maintaining immune homeostasis. The expression of ADAMDEC1 is modulated during various pathological conditions, suggesting that it could serve as a biomarker for disease progression or as a therapeutic target. Researchers are increasingly focusing on the recombinant production of ADAMDEC1 protein to investigate its structure-function relationship, functional mechanisms, and potential applications in biomedicine. Understanding this protein's role in immune regulation may pave the way for novel strategies in treating autoimmune diseases, chronic inflammation, and other related disorders, highlighting the importance of further research into ADAMDEC1 and its pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US