Analytical Data
-
Gene name
ADAMDEC1
-
简介
ADAMDEC1 Protein, Human (HEK293, His) is human recombinant ADAM-like protein decysin-1 (ADAMDEC1) with a 6His tag at the C-terminus.ADAMDEC1 Protein, Human (HEK293, His) is produced by mammalian expression system in human cells.
- Application
-
Alternative Names
rHuADAM-like protein decysin-1, His; ADAMDEC-1; ADAM-like protein decysin-1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15204
-
Expression Region
K206-E470
-
AA Sequence
KSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
38.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADAMDEC1, a member of the ADAM (A Disintegrin and Metalloproteinase) family, is a transmembrane protein known for its role in cell adhesion, migration, and proteolytic activity. It is primarily expressed in dendritic cells and has garnered interest due to its involvement in immune responses and potential implications in inflammatory diseases. Recent studies have shown that ADAMDEC1 can regulate the function of dendritic cells and influence T-cell activation, indicating its crucial role in maintaining immune homeostasis. The expression of ADAMDEC1 is modulated during various pathological conditions, suggesting that it could serve as a biomarker for disease progression or as a therapeutic target. Researchers are increasingly focusing on the recombinant production of ADAMDEC1 protein to investigate its structure-function relationship, functional mechanisms, and potential applications in biomedicine. Understanding this protein's role in immune regulation may pave the way for novel strategies in treating autoimmune diseases, chronic inflammation, and other related disorders, highlighting the importance of further research into ADAMDEC1 and its pathways.
