Analytical Data
-
Gene name
TFPI
-
简介
TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa). In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Tissue factor pathway inhibitor; TFPI; EPI; LACI
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
NP_035706.1
-
Expression Region
L29-K289
-
AA Sequence
LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK
-
Protein Length
Partial
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tissue factor pathway inhibitor (TFPI) is a critical regulator of the coagulation cascade, playing a vital role in maintaining hemostasis and preventing thrombosis. Discovered in the 1980s, TFPI acts primarily by inhibiting factor Xa and tissue factor (TF), thereby controlling the formation of the thrombin complex necessary for blood clotting. Given its central role in coagulation, researchers have focused on developing recombinant forms of TFPI for therapeutic applications. These recombinant proteins have potential use in treating various thromboembolic disorders, including deep vein thrombosis and pulmonary embolism, as well as in preventing clot formation in patients undergoing certain surgical procedures. The production of recombinant TFPI presents challenges, including ensuring proper folding, post-translational modifications, and bioactivity. Advances in biotechnology, such as genetic engineering techniques, have enabled the successful expression of TFPI in different host systems, including bacteria and mammalian cells. Recent studies have highlighted the efficacy of recombinant TFPI in preclinical models, demonstrating its ability to modulate coagulation pathways effectively. This progress paves the way for clinical trials aimed at evaluating its safety and efficacy, potentially offering new therapeutic avenues for patients at risk of thrombotic events. Overall, the research on TFPI recombinant proteins holds promise for enhancing our understanding of coagulation biology and developing targeted treatments for thrombotic diseases.











