Cat: IPD-X22945

Recombinant Human Haptoglobin Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Haptoglobin

  • 简介

    Haptoglobin captures and binds free plasma hemoglobin, preventing kidney damage and promoting hepatic recycling of heme iron. It acts as an antioxidant, exhibits antibacterial activity, and modulates various aspects of the acute phase response. Haptoglobin Protein, Human (HEK293, His) is the recombinant human-derived Haptoglobin protein, expressed by HEK293, with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuHaptoglobin/HP, His; Haptoglobin; Zonulin; HP

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00738-1

  • Expression Region

    P00738-1 (V19-Q160&I162-N406)

  • AA Sequence

    VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ&ILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

  • Molecular Weight

    16&40-75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Haptoglobin is a crucial plasma protein that binds free hemoglobin released during hemolysis, preventing its oxidative damage and facilitating its clearance by macrophages. This protein exists in various genetic polymorphisms, with distinct isoforms exhibiting different functional properties. The study of recombinant haptoglobin has gained prominence due to its potential therapeutic applications in conditions such as hemolytic anemia, sepsis, and chronic inflammatory diseases, where free hemoglobin levels are elevated. Advancements in recombinant DNA technology have enabled the production of haptoglobin isoforms with controlled properties, allowing researchers to investigate their specific roles in oxidative stress responses and immune modulation. Furthermore, the characterization of recombinant haptoglobin can provide insights into its protective mechanisms against kidney injury and organ dysfunction related to hemolysis. High-throughput screening and structural studies of these isoforms may reveal new avenues for drug development. As such, the study of recombinant haptoglobin not only enhances our understanding of its biological function but also holds promise for innovative therapeutic strategies targeting diseases associated with hemolysis and oxidative damage.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US