Analytical Data
-
Gene name
DKK-1
- Application
-
Biological Activity
1.The ED50 is <6 μg/mL as measured in stimulation of alkaline phosphatase activity using CCl-226 cells. 2.Measured by its ability to inhibit Wnt3a induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1852 μg/mL in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 5.399×103 units/mg. Measured by its ability to inhibit Wnt3a induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1852 μg/mL in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 5.399×103 units/mg.
-
Alternative Names
rMuDKK-1; mDkk-1; Dickkopf-1
-
Species
Mouse
-
Source
CHO
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
O54908
-
Expression Region
S30-H272
-
AA Sequence
SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQAS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
19-22 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C-Reactive Protein (CRP) is an acute-phase protein produced primarily by the liver in response to inflammation. Its synthesis is upregulated by pro-inflammatory cytokines, particularly interleukin-6 (IL-6), making it a crucial biomarker for various inflammatory diseases and conditions, such as infections, autoimmune disorders, and chronic inflammatory diseases. Research into CRP has gained significant traction over the years, as it plays an essential role in the body's innate immune response, mediating various inflammatory processes, including opsonization and complement activation. The recombinant form of CRP (rCRP) has been developed to better understand its function and potential therapeutic applications. By producing rCRP through recombinant DNA technology, researchers aim to study its structure-function relationships, interactions with other molecules, and potential as a therapeutic agent. Furthermore, studies on rCRP can provide insights into its role in modulating immune responses, which could lead to innovative treatments for inflammatory diseases. Additionally, the investigation of rCRP offers the possibility of developing more sensitive diagnostic tools for early detection of inflammatory conditions. Overall, the research on C-Reactive Protein, particularly its recombinant form, holds promise for advancing our understanding of inflammation and its associated diseases, ultimately contributing to improved patient care and novel therapeutic strategies.











