Analytical Data
-
Gene name
ATG4A
- Application
-
Alternative Names
rHuATG4A, His; Cysteine Protease ATG4A; AUT-Like 2 Cysteine Endopeptidase; ATG4A; APG4A; AUTL2
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8WYN0-1
-
Expression Region
M1-V398
-
AA Sequence
MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
40-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATG4A, or autophagy-related protein 4A, plays a crucial role in the autophagy process, a cellular mechanism essential for degrading and recycling cellular components. This protein is part of the ATG4 family, which is characterized by their cysteine protease activity involved in the processing of autophagy proteins. Research has shown that ATG4A is essential for the cleavage of the LC3 precursor protein, converting it into its lipidated form, LC3-II, which is critical for the formation of autophagosomes. Dysregulation of autophagy and, by extension, ATG4A is linked to various pathologies, including neurodegenerative diseases, cancer, and infections. Scientists are increasingly investigating the activity and regulation of ATG4A to better understand its functions and implications in these diseases, as well as its potential as a therapeutic target. Recombinant ATG4A protein studies provide insights into its enzymatic properties, interaction with other proteins, and effects on cellular autophagic processes. This research is significant for developing new strategies to manipulate autophagy for therapeutic benefits, particularly in diseases where autophagy is impaired or altered.
