Recombinant Human ST2/IL1RL1 Protein (HEK293)，His

ST2/IL1RL1

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

1.Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.7922 ng/mL in the presence of 10 ng/mL recombinant mouse IL-33, corresponding to a specific activity is 1.2623×106 units/mg. 2.Measured by its ability to bind human IL33 in functional Elisa. 3. Loaded ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) on AHC2 biosensor, can bind Astegolimab (HY-P99444) with an affinity constant of 2.022E-10 M as determined in BLI assay. Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.7922 ng/mL in the presence of 10 ng/mL recombinant mouse IL-33, corresponding to a specific activity is 1.2623×106 units/mg. Loaded ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) on AHC2 biosensor, can bind Astegolimab (HY-P99444) with an affinity constant of 2.022E-10 M as determined in BLI assay.

Interleukin-1 receptor-like 1; Protein ST2; DER4; ST2; T1

Human

HEK293

C-His

Greater than 90% as determined by SDS-PAGE.

Q01638-2

K19-F328

KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF

Extracellular Domain

52-60 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.