Recombinant Human Apolipoprotein A-I/APOA1 Protein (HEK293)，hFc

Apolipoprotein A-I/APOA1

Apolipoprotein AI plays a key role in reverse cholesterol transport, promoting cholesterol efflux from tissues and acting as a cofactor for lecithin cholesterol acyltransferase (LCAT). It forms homodimers and participates in the SPAP complex, which is essential for sperm motility, interacting with both NAXE and CLU. Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Human MSR (HY-P76781). The ED50 for this effect is 1.846 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Human MSR (HY-P76781) .The ED50 for this effect is 1.846 μg/mL.

Apolipoprotein A-I; Apo-AI; ProapoA-I; APOA1

Human

HEK293

C-hFc

Greater than 95% as determined by SDS-PAGE.

P02647

D25-Q267

DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Partial

55-65 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.