Analytical Data
-
Gene name
IL-22RA2
-
简介
IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, His) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit IL-22-induced IL-10 secretion by COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 1.736 ng/mL in the presence of 1 ng/mL of Human IL-22, corresponding to a specific activity is 5.76×105 U/mg. Measured by its ability to inhibit IL-22-induced IL-10 secretion by COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 1.736 ng/mL in the presence of 1 ng/mL of Human IL-22, corresponding to a specific activity is 5.76×105 U/mg.
-
Alternative Names
Interleukin-22 receptor subunit alpha-2; IL-22RA2; CRF2-10; CRF2-S1; IL-22BP; ZcytoR16
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
Q969J5
-
Expression Region
T22-P231
-
AA Sequence
TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
-
Protein Length
Partial
-
Molecular Weight
40-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-22 receptor subunit alpha 2 (IL-22RA2) is a decoy receptor that plays a critical role in regulating the immune response, particularly in inflammation and tissue regeneration. Unlike its counterpart IL-22RA1, which is part of the signaling complex for the pro-inflammatory cytokine IL-22, IL-22RA2 functions by binding to IL-22 and inhibiting its activity, thus preventing excessive inflammatory responses. This mechanism is particularly significant in various diseases, including autoimmune disorders, infections, and certain types of cancer. The study of IL-22RA2 as a recombinant protein has gained attention due to its potential therapeutic implications. Researchers are exploring its role in modulating the immune response to restore balance in inflammatory conditions while also investigating its utility as a biomarker for diseases characterized by dysregulated IL-22 signaling. Recombinant IL-22RA2 could serve as a valuable tool for understanding the complexities of cytokine interactions and the therapeutic modulation of immune responses. By elucidating its structure, function, and interactions with other cytokines, this research may pave the way for new treatment strategies targeting IL-22-related pathways, offering hope for improved management of chronic inflammatory diseases.











