Analytical Data
-
Gene name
FOLR1
-
简介
The FOLR1 protein is an important mediator of folate uptake, binding to folate and promoting the delivery of 5-methyltetrahydrofolate into cells. Studies show high affinity at neutral pH. FOLR1 Protein, Human (HEK293, His) is the recombinant human-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
1. Measured by its binding ability in a functional ELISA. Immobilized FOLR1 at 1 μg/mL can bind Anti-FOLR1 antibody, Mouse IgG1, the EC50 of human FOLR1 protein is ≤9.719 ng/mL, corresponding to a specific activity is ≥1.029×105 units/mg. 2. Loaded Luveltamab (HY-P990687) on AHC2 biosensor, can bind FOLR1 Protein, Human (HEK293, His) with an affinity constant of 3.314E-09 M as determined in BLI assay. Measured by its binding ability in a functional ELISA. Immobilized FOLR1 at 1 μg/ml can bind Anti-FOLR1 antibody, Mouse IgG1, the EC50 of human FOLR1 protein is 7.461 ng/mL, corresponding to a specific activity is 1.340×105 units/mg. Loaded Luveltamab (HY-P990687) on AHC2 biosensor, can bind FOLR1 Protein, Human (HEK293, His) with an affinity constant of 3.314E-09 M as determined in BLI assay.
-
Alternative Names
rHuFolate receptor alpha/FOLR1, His; Folate receptor alpha; FR-alpha; Adult folate-binding protein; FBP; Folate receptor 1; Folate receptor; Ovarian tumor-associated antigen MOv18; FOLR1
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15328
-
Expression Region
R25-S234
-
AA Sequence
RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
34-38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process











