Cat: IPD-X22296

Recombinant Human TROP-2 Protein(HEK293), hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TROP-2

  • 简介

    The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (187a.a, HEK293, Fc) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tumor-associated calcium signal transducer 2; Membrane component chromosome 1 surface marker 1; Cell surface glycoprotein Trop-2; TACSTD2; TROP2

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09758

  • Expression Region

    T88-T274

  • AA Sequence

    TLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

  • Protein Length

    Partial

  • Molecular Weight

    60-80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TROP-2, a transmembrane glycoprotein, has emerged as a significant target in cancer research due to its overexpression in various malignancies, including breast, lung, and colon cancers. Initially identified as an early developmental marker, TROP-2 plays a critical role in cellular adhesion and signaling pathways that promote tumor growth and metastasis. Its involvement in cancer progression has led to increased interest in developing TROP-2-targeted therapies, such as antibody-drug conjugates (ADCs) that deliver cytotoxic agents specifically to tumor cells expressing this protein. The unique expression pattern of TROP-2 in tumors, coupled with its limited presence in normal tissues, underscores its potential as a therapeutic target. Recent studies have focused on elucidating the molecular mechanisms by which TROP-2 contributes to oncogenesis and exploring its potential in combination therapies to enhance treatment efficacy. As a result, the development of TROP-2-targeted therapies is poised to improve outcomes for patients with TROP-2-positive cancers, making it a critical area of investigation in the quest for more effective cancer treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US