Analytical Data
-
Gene name
Fc gamma RIIIB/CD16b
-
简介
Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Application
-
Alternative Names
CD16b; CD16-B; FCGR3-B; FCG3; FcgRIII; Low affinity immunoglobulin gamma Fc region receptor III-B
-
Species
Human
-
Source
HEK293
-
Tag
C-Avi;C-8*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75015
-
Expression Region
G17-S200
-
AA Sequence
GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
47-53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fc gamma RIIIB (CD16b) is a vital receptor involved in the immune response, specifically in the recognition and binding of immunoglobulin G (IgG) antibodies by immune effector cells such as neutrophils and natural killer (NK) cells. This receptor plays a crucial role in antibody-dependent cellular cytotoxicity (ADCC) and the modulation of inflammation. Unlike its counterpart CD16a, CD16b is a glycosylphosphatidylinositol (GPI)-anchored protein found predominantly on human neutrophils. The understanding and characterization of CD16b are critical for unraveling its role in various immune-mediated conditions and therapeutic contexts, including autoimmune diseases, infections, and cancer immunotherapy. Research on recombinant CD16b proteins has been propelled by the need for tools to study binding affinity, receptor functionality, and the development of novel therapeutic agents. The generation of recombinant CD16b not only facilitates investigations into the structural and functional aspects of the receptor but also offers potential for the engineering of bispecific antibodies and other biologics aimed at enhancing immune responses. Understanding the dynamics of Fc receptor interactions is essential for improving therapeutic strategies that leverage the immune system, paving the way for advancements in targeted therapies and immunotherapy approaches. As such, recombinant Fc gamma RIIIB/CD16b proteins are invaluable for both basic research and the development of innovative clinical applications.











